PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009627333.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 446aa    MW: 50925.9 Da    PI: 4.6756
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009627333.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box292.3e-091759440
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    r C+++ +k+++++C  ++ +lC++C ++ H+       H++v
  XP_009627333.1 17 RACDNCIRKRARWYCPADDAFLCQNCDSSVHSAnplarrHERV 59
                    67*****************************667888888876 PP

2CCT67.92.8e-23393436144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  XP_009627333.1 393 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS 436
                     9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.8E-111461IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8651461IPR000315B-box-type zinc finger
PfamPF006431.2E-71759IPR000315B-box-type zinc finger
CDDcd000211.22E-101761No hitNo description
PfamPF062036.0E-18393435IPR010402CCT domain
PROSITE profilePS5101716.083393435IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MVSDRKLASA MGGKTTRACD NCIRKRARWY CPADDAFLCQ NCDSSVHSAN PLARRHERVR  60
LKTSPLKESS PDENFPNLES PVSVSLPSWH RGFTRKARTP RNGRKVSKST EEEEEEEEEE  120
EEEVILKNPI HLVPEILSDE NSLDENEEQL LYRVPIFDPF VAELCTSATR NDQIENVQTA  180
TETDPEFKLE SKEMHKHDIC NDDLNTFHGM LPSEMELAEF AADVESLLGK GLEDESFDME  240
GLGLLGGCNK EENSMECSMV SNEKVKIEDE VVMDTTTTSH DIDINGDTFE FKIDYDSPIN  300
INGEDEVGEV VMKINGEDGV VGDGNYNEKK KILLNLDYES VLTAWADQRS PWTNGERPEL  360
DSNDCWPDCM GNCGTIHPYG IMNGHTTMID RGREARVSRY REKRRTRLFS KKIRYEVRKL  420
NAEKRPRMKG RFVKRSNLVP NYPLLK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1403419RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754443e-62HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755173e-62HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009627333.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
TrEMBLM1B5V10.0M1B5V1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000377550.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15392470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.11e-96B-box type zinc finger protein with CCT domain